Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00606) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Programmed cell death 1 ligand 1
|
|||||
| Synonyms |
PD-L1; PDCD1 ligand 1; Programmed death ligand 1; B7 homolog 1; B7-H1; CD Antigen CD274
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
immunoglobulin superfamily;
BTN/MOG family. |
|||||
| Gene Name |
Cd274
|
|||||
| Organism |
Mus musculus (Mouse)
|
|||||
| Function |
Plays a critical role in induction and maintenance of immune tolerance to self.; As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response.; Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10); The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival.; The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function.; The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MRIFAGIIFTACCHLLRAFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKE
DEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIISYGG ADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSV TTSRTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQNHTAELIIPELPATHPPQNRTHW VLLGSILLFLIVVSTVLLFLRKQVRMLDVEKCGVEDTSSKNRNDTQFEET |
|||||
| Sequence Length |
290
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affibody anti-SARS-CoV-2 M1 | Research | binder | Kd: 9.5 nM | Tools for PD-L1 imaging and therapy | [1] | |