Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00137) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Programmed cell death protein 1
|
|||||
| Synonyms |
Protein PD-1; hPD-1; CD antigen CD279
|
|||||
| BTS Type |
Protein
|
|||||
| Gene Name |
PDCD1
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/PDCD1LG2 Following T-cell receptor (TCR) engagement, PDCD1 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation (By similarity). Suppresses T-cell activation through the recruitment of PTPN11/SHP-2: following ligand-binding, PDCD1 is phosphorylated within the ITSM motif, leading to the recruitment of the protein tyrosine phosphatase PTPN11/SHP-2 that mediates dephosphorylation of key TCR proximal signaling molecules, such as ZAP70, PRKCQ/PKCtheta and CD247/CD3zeta (By similarity).; The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival The interaction with CD274/PDCD1L1 inhibits cytotoxic T lymphocytes (CTLs) effector function The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL |
|||||
| Sequence Length |
288
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| DARPin anti-PD-1 DARPin-1 | Research | Blocker | N.A. | Ovarian cancer [ICD-11: 2C73.Z] | [1] | |
| DARPin anti-PD-1 DARPin-2 | Research | Blocker | N.A. | Ovarian cancer [ICD-11: 2C73.Z] | [1] | |
| DART MGD-019 | Phase I | Inhibitor | N.A. | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | [2] | |
| DART Tebotelimab | Phase III | Inhibitor | N.A. | Solid tumour/cancer [ICD-11: 2A00-2F9Z]; Heme Malignancies | [2] | |
| Diabody anti-c-Met/PD-1 Diabody-mp | Research | inhibitor | Kd: 0.63 nM | Tumors [ICD-11: XH1N44] | [3] | |
| Diabody anti-c-Met/PD-1 Diabody-pm | Research | inhibitor | Kd: 32.48 nM | Tumors [ICD-11: XH1N44] | [3] | |
| Diabody anti-VEGF x anti-PD-1 | Research | Inhibitor | Kd: 25.1 nM | Tumors [ICD-11: XH1N44] | [4], [5] | |
| Miniprotein anti-PD-1 DBL2_03 | Research | binder | Kd: 4200 nM | Research tool | [6] | |
| Miniprotein anti-PD-1 DBL2_04 | Research | binder | N.A. | Research tool | [6] | |
| Miniprotein anti-PD-1 DBP13_01 | Research | binder | N.A. | Research tool | [6] | |
| References |
|---|