Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000158) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
DART Tebotelimab
|
|||||
| Synonyms |
MGD013
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Highest Status | Phase III | |||||
| Sequence Length | 455 | |||||
| SBP Sequence |
>VH1 Chain
QVQLVQSGAEVKKPGASVKVSCKASGYSFTSYWMNWVRQAPGQGLEWIGVIHPSDSETWL DQKFKDRVTITVDKSTSTAYMELSSLRSEDTAVYYCAREHYGTSPFAYWGQGTLVTVSS >VL1 Chain EIVLTQSPATLSLSPGERATLSCRASESVDNYGMSFMNWFQQKPGQPPKLLIHAASNQGS GVPSRFSGSGSGTDFTLTISSLEPEDFAVYFCQQSKEVPYTFGGGTKVEIK >VH2 Chain QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYNMDWVRQAPGQGLEWMGDINPDNGVTIY NQKFEGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAREADYFYFDYWGQGTTLTVSS >VL2 Chain DIQMTQSPSSLSASVGDRVTITCRASQDVSSVVAWYQQKPGKAPKLLIYSASYRYTGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQHYSTPWTFGGGTKLEIK |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS028 | [1] | ||||
| Scaffold Name | DART | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Programmed cell death protein 1 | Inhibitor | Solid tumour/cancer [ICD-11: 2A00-2F9Z]; Heme Malignancies | N.A. | MacroGenics | [1] | |
| Lymphocyte activation gene 3 protein | Inhibitor | Solid tumour/cancer [ICD-11: 2A00-2F9Z]; Heme Malignancies | N.A. | MacroGenics | [1] | |
| Clinical Trial Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| NCT03219268 | Click to show the Detail | |||||
| Indication | Advanced Solid Tumors; Hematologic Neoplasms;Ovarian Cancer; HER2-positive Advanced Solid Tumors; Non Small Cell Lung Cancer; Small-cell Lung Cancer; Squamous Cell Carcinoma of Head and Neck Cholangiocarcinoma; Cervical Cancer; TNBC - Triple-Negative Breast Cancer | |||||
| Phase | Phase I | |||||
| Title | A Study of MGD013 in Patients With Unresectable or Metastatic Neoplasms | |||||
| Status | Completed | |||||
| Sponsor | MacroGenics | |||||
| NCT04082364 | Click to show the Detail | |||||
| Indication | Gastric Cancer; Gastroesophageal Junction Cancer; HER2-positive Gastric Cancer | |||||
| Phase | Phase II; Phase III | |||||
| Title | Combination Margetuximab, Retifanlimab, Tebotelimab, and Chemotherapy Phase 2/3 Trial in HER2+ Gastric/GEJ Cancer | |||||
| Status | Active, not recruiting | |||||
| Sponsor | MacroGenics | |||||
| NCT04129320 | Click to show the Detail | |||||
| Indication | Head and Neck Cancer; Squamous Cell Carcinoma of Head and Neck | |||||
| Phase | Phase II; Phase III | |||||
| Title | Enoblituzumab Plus MGA012 or MGD013 in Squamous Cell Carcinoma of the Head and Neck | |||||
| Status | Withdrawn | |||||
| Sponsor | MacroGenics | |||||
| NCT04178460 | Click to show the Detail | |||||
| Indication | Gastric Cancer; Triple Negative Breast Cancer; Biliary Tract Carcinoma; Endometrial Carcinoma | |||||
| Phase | Phase I | |||||
| Title | A Study of Niraparib Combined With MGD013 in Patients With Advanced or Metastatic Solid Tumor Who Failed Prior Treatment | |||||
| Status | Terminated | |||||
| Sponsor | Zai Lab (Shanghai) Co., Ltd. | |||||
| NCT04212221 | Click to show the Detail | |||||
| Indication | Advanced Hepatocellular Carcinoma (HCC) | |||||
| Phase | Phase I; Phase II | |||||
| Title | MGD013 Monotherapy and Combination With Brivanib Dose Escalation and Expansion Study in Advanced Liver Cancer Patients | |||||
| Status | Terminated | |||||
| Sponsor | Zai Lab (Shanghai) Co., Ltd. | |||||
| NCT04634825 | Click to show the Detail | |||||
| Indication | Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck | |||||
| Phase | Phase II | |||||
| Title | A Phase II Open-Label Trial to Evaluate Enoblituzumab in Combination With Retifanlimab or?Tebotelimab?in the First-Line Treatment of Patients With Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck | |||||
| Status | Recruiting | |||||
| Sponsor | MacroGenics | |||||
| NCT04653038 | Click to show the Detail | |||||
| Indication | Unresectable, Recurrent or Metastatic Melanoma; Untreated Mucosal or Acral Lentiginous Melanoma | |||||
| Phase | Phase I | |||||
| Title | A Study to Evaluate the Safety and Efficacy of MGD013 in Patients With Melanoma | |||||
| Status | Terminated | |||||
| Sponsor | Zai Lab (Shanghai) Co., Ltd. | |||||