Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00041) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Lymphocyte activation gene 3 protein
|
|||||
| Synonyms |
LAG-3; CD antigen CD223
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
LAG3 family
|
|||||
| Gene Name |
LAG3
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Lymphocyte activation gene 3 protein: Inhibitory receptor on antigen activated T-cells Delivers inhibitory signals upon binding to ligands, such as FGL1 (By similarity). FGL1 constitutes a major ligand of LAG3 and is responsible for LAG3 T-cell inhibitory function (By similarity). Following TCR engagement, LAG3 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation (By similarity). May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1, possibly by acting as a coreceptor for PDCD1/PD-1 (By similarity). Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells Also mediates immune tolerance: constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function (By similarity). Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation (By similarity). Binds MHC class II (MHC-II); the precise role of MHC-II-binding is however unclear ; [Secreted lymphocyte activation gene 3 protein]: May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| Gene ID | ||||||
| Sequence |
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAG
VTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLR ASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWG CILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGS PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERL LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRP RRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL |
|||||
| Sequence Length |
525
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affimer anti-LAG-3 AVA-017 | Research | Antagonist | N.A. | Cancers [ICD-11: 2D4Z] | [1] | |
| Affimer anti-PD-L1/LAG-3 AVA-021 | Research | Inhibitor | N.A. | Tumors [ICD-11: XH1N44] | [1] | |
| DART Tebotelimab | Phase III | Inhibitor | N.A. | Solid tumour/cancer [ICD-11: 2A00-2F9Z]; Heme Malignancies | [2] | |