Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00081) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
E3 ubiquitin-protein ligase Mdm2
|
|||||
| Synonyms |
EC 2.3.2.27; Double minute 2 protein; Hdm2; Oncoprotein Mdm2; RING-type E3 ubiquitin transferase Mdm2; p53-binding protein Mdm2
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
MDM2/MDM4 family
|
|||||
| Gene Name |
MDM2
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome. Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes them to proteasomal degradation Ubiquitinates DCX, leading to DCX degradation and reduction of the dendritic spine density of olfactory bulb granule cells (By similarity). Ubiquitinates DLG4, leading to proteasomal degradation of DLG4 which is required for AMPA receptor endocytosis (By similarity). Negatively regulates NDUFS1, leading to decreased mitochondrial respiration, marked oxidative stress, and commitment to the mitochondrial pathway of apoptosis Binds NDUFS1 leading to its cytosolic retention rather than mitochondrial localization resulting in decreased supercomplex assembly (interactions between complex I and complex III), decreased complex I activity, ROS production, and apoptosis
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ PIQMIVLTYFP |
|||||
| Sequence Length |
491
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Beta-Hairpin mimetic anti-MDM2 clone?1 | Research | Inhibitor | Kd: 127 nM | Tools for inhibiting the MDM2/p53 protein-protein interaction | [1] | |
| Beta-Hairpin mimetic anti-MDM2 clone?2 | Research | Inhibitor | Kd: 7000 nM | Tools for inhibiting the MDM2/p53 protein-protein interaction | [1] | |
| Beta-Hairpin mimetic anti-MDM2 clone?3 | Research | Inhibitor | Kd: 5730 nM | Tools for inhibiting the MDM2/p53 protein-protein interaction | [1] | |
| Beta-Hairpin mimetic anti-MDM2 clone?4 | Research | Inhibitor | Kd: 2500 nM | Tools for inhibiting the MDM2/p53 protein-protein interaction | [1] | |
| CI2-based binder anti-MDM2 CI2-12.1 | Research | Binder | N.A. | Research tool | [2] | |
| CI2-based binder anti-MDM2 CI2-12.1-Ala | Research | Binder | N.A. | Research tool | [2] | |
| CI2-based binder anti-MDM2 CI2-Arf37 | Research | Binder | N.A. | Research tool | [2] | |
| Cyclotide anti-MDM2/HdmX MCo-PMI-6CIW | Research | Antagonist | N.A. | p53 tumor | [3] | |
| Cyclotide anti-MDM2/HdmX MCo-PMI-K37R | Research | Antagonist | Kd: 2.3 nM | p53 tumor | [3] | |
| scFv anti-MDM2 M1-19 | Research | Binder | Kd: 4.3 nM | Research tool | [4] | |
| scFv anti-MDM2 M1-19a | Research | Binder | Kd: 0.34 nM | Research tool | [4] | |
| References |
|---|