Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000568)
SBP Name
Cyclotide anti-MDM2/HdmX MCo-PMI-K37R
Synonyms
Cyclotide MCo-PMI-K37R
Molecular Weight 5.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Highest Status Research
Sequence Length 51
SBP Sequence
>Cyclotide anti-MDM2/HdmX MCo-PMI-K37R
GGVCPKILQRCRRDSDCPGACICRGNGYCGSGSGASRAPTSFAEYWNLLSA
Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds; MCo-PMI-K37R is the C-to-N cyclized peptides.
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name MCoTI-I
Template Sequence Description Cys I and Cys IV form disulfide bonds; Cys II and Cys V form disulfide bonds; Cys III and Cys VI form disulfide bonds.
Protein Scaffold Information of This SBP
Scaffold ID PS023
Scaffold Info
[1]
Scaffold Name Cyclotide
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Protein Mdm4
BTS Info
Antagonist p53 tumor Kd: 9.7 nM University of Southern California [1]
E3 ubiquitin-protein ligase Mdm2
BTS Info
Antagonist p53 tumor Kd: 2.3 nM University of Southern California [1]
References
1 In vivo activation of the p53 tumor suppressor pathway by an engineered cyclotide. J Am Chem Soc. 2013 Aug 7;135(31):11623-11633.