Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00051) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Albumin
|
|||||
| Synonyms |
BSA; allergen Bos d 6
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
ALB/AFP/VDB family
|
|||||
| Gene Name |
ALB
|
|||||
| Organism |
Bos taurus (Bovine)
|
|||||
| Function |
Binds water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc (By similarity). Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma (Probable). Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner The shared binding site between zinc and calcium at residue Asp-272 suggests a crosstalk between zinc and calcium transport in the blood (Probable). The rank order of affinity is zinc > calcium > magnesium (Probable). Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli Does not prevent iron uptake by the bacterial siderophore aerobactin
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF
DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA |
|||||
| Sequence Length |
607
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Affitin anti-BSA Sso7d\2A8 | Research | Binder | Kd: 3500 nM | Diagnostics and therapeutics for environments with extreme conditions of storage and deployment | [1] | |
| Cytochrome b562-based binder anti-BSA-1 conjugate C13 | Research | Binder | Kd: 5000 nM | Tools for molecular recognition | [2] | |
| Cytochrome b562-based binder anti-BSA-1 conjugate C18 | Research | Binder | Kd: 8600 nM | Tools for molecular recognition | [2] | |
| Cytochrome b562-based binder anti-BSA-1 conjugate C22 | Research | Binder | Kd: 9400 nM | Tools for molecular recognition | [2] | |
| Cytochrome b562-based binder anti-BSA-1 conjugate C30 | Research | Binder | Kd: 22000 nM | Tools for molecular recognition | [2] | |
| Fab anti-Progesterone-BSA A11 | Research | Binder | N.A. | Research tool | [3] | |
| Fab anti-Progesterone-BSA B6 | Research | Binder | N.A. | Research tool | [3] | |
| Fab anti-Progesterone-BSA F1 | Research | Binder | N.A. | Research tool | [3] | |
| scFv anti-BSA-O-polysaccharide B3-19 | Research | Binder | N.A. | Research tool | [4] | |
| scFv anti-BSA-O-polysaccharide B3-20 | Research | Binder | N.A. | Research tool | [4] | |
| scFv anti-BSA-O-polysaccharide B5-1/B1-4 | Research | Binder | N.A. | Research tool | [4] | |
| scFv anti-BSA-O-polysaccharide B5-6 | Research | Binder | N.A. | Research tool | [4] | |
| scFv anti-BSA-O-polysaccharide Glyl09Ser | Research | Binder | N.A. | Tools as a tendency to dimerize | [4] | |
| References |
|---|