Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000651) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affitin anti-BSA Sso7d\2A8
|
|||||
| Synonyms |
Affitin Sso7d\BSA\2A8
|
|||||
| Molecular Weight | 7.3 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 64 | |||||
| SBP Sequence |
>Affitin anti-BSA Sso7d\2A8
MATVKFKYKGEEKEVDISKIWYVVRDGKFINFIYDLGGGKSGYGGVSEKDAPKELLQMLE KQKK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Sso7d | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS007 | [1] | ||||
| Scaffold Name | Affitin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Albumin | Binder | Diagnostics and therapeutics for environments with extreme conditions of storage and deployment | Kd: 3500 nM | Colorado State University | [1] | |