Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000869)
SBP Name
Cytochrome b562-based binder anti-BSA-1 conjugate C18
Synonyms
Cytochrome b562-based binder conjugate C18
Molecular Weight 12.0 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 106
SBP Sequence
>Cytochrome b562-based binder anti-BSA-1 conjugate C18
ADLEDNMETLNDNLKVIEAWRSGAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANAERWKEAQAAAEQLKTTRNAYHQKYR
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Cytochrome b562
Protein Scaffold Information of This SBP
Scaffold ID PS024
Scaffold Info
[1]
Scaffold Name Cytochrome b562-based binder
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Albumin
BTS Info
Binder Tools for molecular recognition Kd: 8600 nM University of California [1]
References
1 Alternate protein frameworks for molecular recognition. Proc Natl Acad Sci U S A. 1995 Jul 3;92(14):6552-6.