Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00269) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Large envelope protein
|
|||||
| Synonyms |
L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Orthohepadnavirus major surface antigen family
|
|||||
| Gene Name |
PreS1
|
|||||
| Organism |
Hepatitis B virus (HBV)
|
|||||
| Function |
The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. This attachment induces virion internalization predominantly through caveolin-mediated endocytosis. The large envelope protein also assures fusion between virion membrane and endosomal membrane. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein.; The middle envelope protein plays an important role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid independent way. In this process the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm of diameter that do not contain a nucleocapsid.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPH
GGLLGWSPQAQGILQTVPANPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTL QDPPAGGSSSGTVNPVPTTVSHISSIFTRIGDPALNMENITSGFLGPLLVLQAGFFLLTR ILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFL FILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSD GNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPS LYSILSPFLPLLPIFFCLWAYI |
|||||
| Sequence Length |
382
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| scFv anti-HBV clone 2 | Research | Neutralizer | N.A. | Hepatitis B virus infection [ICD-11: XN0GA] | [1], [2] | |
| scFv anti-HBV clone 3 | Research | Neutralizer | N.A. | Hepatitis B virus infection [ICD-11: XN0GA]; Other specified acute pancreatitis [ICD-11: DC31.Y] | [1], [2] | |
| scFv anti-HBV clone 31 | Research | Neutralizer | N.A. | Hepatitis B virus infection [ICD-11: XN0GA] | [1] | |
| scFv anti-HBV clone 51 | Research | Neutralizer | N.A. | Hepatitis B virus infection [ICD-11: XN0GA] | [1] | |
| scFv anti-HBV clone 59 | Research | Neutralizer | N.A. | Hepatitis B virus infection [ICD-11: XN0GA] | [1] | |
| scFv anti-HBV PreS1/TACE A9 | Research | Binder | Kd: 176 nM | Hepatitis B virus infection [ICD-11: XN0GA] | [3], [4] | |
| scFv anti-pre-S1 1E4 | Research | Inhibitor | Kd: 258 nM | Hepatitis B virus infection [ICD-11: XN0GA] | [3] | |
| scFv anti-pre-S1 A9 | Research | Inhibitor | Kd: 176 nM | Hepatitis B virus infection [ICD-11: XN0GA] | [3] | |
| scFv anti-pre-S1 B2 | Research | Inhibitor | Kd: 64 nM | Hepatitis B virus infection [ICD-11: XN0GA] | [3] | |
| scFv anti-pre-S1 B9 | Research | Inhibitor | Kd: 63 nM | Hepatitis B virus infection [ICD-11: XN0GA] | [3] | |
| References |
|---|