General Information of Binding Target of SBP (BTS) (ID: ST00269)
BTS Name
Large envelope protein
Synonyms
L glycoprotein; L-HBsAg; LHB; Large S protein; Large surface protein; Major surface antigen
BTS Type
Protein
Family
Orthohepadnavirus major surface antigen family
Gene Name
PreS1
Organism
Hepatitis B virus (HBV)
Function
The large envelope protein exists in two topological conformations, one which is termed 'external' or Le-HBsAg and the other 'internal' or Li-HBsAg. In its external conformation the protein attaches the virus to cell receptors and thereby initiating infection. This interaction determines the species specificity and liver tropism. This attachment induces virion internalization predominantly through caveolin-mediated endocytosis. The large envelope protein also assures fusion between virion membrane and endosomal membrane. In its internal conformation the protein plays a role in virion morphogenesis and mediates the contact with the nucleocapsid like a matrix protein.; The middle envelope protein plays an important role in the budding of the virion. It is involved in the induction of budding in a nucleocapsid independent way. In this process the majority of envelope proteins bud to form subviral lipoprotein particles of 22 nm of diameter that do not contain a nucleocapsid.
UniProt ID
Q67886
UniProt Entry
Q67886_HBV
PFam
PF00695
Sequence
MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGLTPPH
GGLLGWSPQAQGILQTVPANPPPASTNRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTL
QDPPAGGSSSGTVNPVPTTVSHISSIFTRIGDPALNMENITSGFLGPLLVLQAGFFLLTR
ILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFL
FILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSD
GNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPS
LYSILSPFLPLLPIFFCLWAYI
Sequence Length
382
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
scFv anti-HBV clone 2 Research Neutralizer N.A. Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[1], [2]
scFv anti-HBV clone 3 Research Neutralizer N.A. Hepatitis B virus infection [ICD-11: XN0GA]; Other specified acute pancreatitis [ICD-11: DC31.Y]
SBP Info
[1], [2]
scFv anti-HBV clone 31 Research Neutralizer N.A. Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[1]
scFv anti-HBV clone 51 Research Neutralizer N.A. Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[1]
scFv anti-HBV clone 59 Research Neutralizer N.A. Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[1]
scFv anti-HBV PreS1/TACE A9 Research Binder Kd: 176 nM Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[3], [4]
scFv anti-pre-S1 1E4 Research Inhibitor Kd: 258 nM Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[3]
scFv anti-pre-S1 A9 Research Inhibitor Kd: 176 nM Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[3]
scFv anti-pre-S1 B2 Research Inhibitor Kd: 64 nM Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[3]
scFv anti-pre-S1 B9 Research Inhibitor Kd: 63 nM Hepatitis B virus infection [ICD-11: XN0GA]
SBP Info
[3]
References
1 Selection of affinity-improved neutralizing human scFv against HBV PreS1 from CDR3 VH/VL mutant library. Biologicals. 2016 Jul;44(4):271-275.
2 Recombinant scFv antibodies against infectious pancreatic necrosis virus isolated by flow cytometry. J Virol Methods. 2016 Nov;237:204-209.
3 Improvement of neutralizing activity of human scFv antibodies against hepatitis B virus binding using CDR3 V(H) mutant library. Viral Immunol. Spring 2006;19(1):115-23.
4 Development of a 'mouse and human cross-reactive' affinity-matured exosite inhibitory human antibody specific to TACE (ADAM17) for cancer immunotherapy. Protein Eng Des Sel. 2014 Jun;27(6):179-90.