Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001767) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-pre-S1 1E4
|
|||||
Synonyms |
scFv 1E4
|
|||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Surface plasmon resonance | |||||
Highest Status | Research | |||||
SBP Sequence |
>VH
QVQLVQSGGGLVKPGGSLRLSCEASGFPFRDAWMTWVRQAPGRGLEWVGRIKKKSDGGAT DYAASVKDRFTISRDDSKNMLWLQMNSLKVEDTAVYYCTRSVSSWYEYFYYYYMDLWGKG TTVTVSS |
|||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Large envelope protein | Inhibitor | Hepatitis B virus infection [ICD-11: XN0GA] | Kd: 258 nM | Inje University | [1] | |