Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001767) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
scFv anti-pre-S1 1E4
|
|||||
| Synonyms |
scFv 1E4
|
|||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Surface plasmon resonance | |||||
| Highest Status | Research | |||||
| SBP Sequence |
>VH
QVQLVQSGGGLVKPGGSLRLSCEASGFPFRDAWMTWVRQAPGRGLEWVGRIKKKSDGGAT DYAASVKDRFTISRDDSKNMLWLQMNSLKVEDTAVYYCTRSVSSWYEYFYYYYMDLWGKG TTVTVSS |
|||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS057 | [1] | ||||
| Scaffold Name | scFv | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Large envelope protein | Inhibitor | Hepatitis B virus infection [ICD-11: XN0GA] | Kd: 258 nM | Inje University | [1] | |