General Information of Binding Target of SBP (BTS) (ID: ST00258)
BTS Name
Advanced glycosylation end product-specific receptor
Synonyms
Receptor for advanced glycosylation end products
BTS Type
Protein
Gene Name
AGER
Organism
Homo sapiens (Human)
Function
Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.
UniProt ID
Q15109
UniProt Entry
RAGE_HUMAN
PFam
PF08205 ; PF00047 ; PF13895
Gene ID
177
Sequence
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP
Sequence Length
404
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Pronectin anti-RAGE R2F8 Research Inhibitor N.A. Research tool
SBP Info
[1]
scFv anti-RAGE 10D8 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 10H6 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 1G6 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 2E6 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 3A6 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 3B2 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 3B3 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 3B4 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 3D2 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 3G5 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 5A3 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 6B2 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 6B6 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 6C2 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 6C3 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 6G4 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE 8G9 Research Blocker N.A. Research tool
SBP Info
[2]
scFv anti-RAGE M4 Research Binder IC50: 33 nM Research tool
SBP Info
[2]
References
1 RAGE and TLRs: relatives, friends or neighbours?Mol Immunol. 2013 Dec;56(4):739-44.
2 Affinity maturation of a humanized rat antibody for anti-RAGE therapy: comprehensive mutagenesis reveals a high level of mutational plasticity both inside and outside the complementarity-determining regions. J Mol Biol. 2009 May 8;388(3):541-58.