Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00258) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Advanced glycosylation end product-specific receptor
|
|||||
Synonyms |
Receptor for advanced glycosylation end products
|
|||||
BTS Type |
Protein
|
|||||
Gene Name |
AGER
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP |
|||||
Sequence Length |
404
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Pronectin anti-RAGE R2F8 | Research | Inhibitor | N.A. | Research tool | [1] | |
scFv anti-RAGE 10D8 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 10H6 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 1G6 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 2E6 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 3A6 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 3B2 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 3B3 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 3B4 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 3D2 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 3G5 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 5A3 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 6B2 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 6B6 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 6C2 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 6C3 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 6G4 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE 8G9 | Research | Blocker | N.A. | Research tool | [2] | |
scFv anti-RAGE M4 | Research | Binder | IC50: 33 nM | Research tool | [2] | |
References |
---|