Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001824) | ||||||
---|---|---|---|---|---|---|
SBP Name |
scFv anti-RAGE 10H6
|
|||||
Synonyms |
scFv 10H6
|
|||||
Molecular Weight | 25.7 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display and Ribosome display | |||||
Highest Status | Research | |||||
Sequence Length | 242 | |||||
SBP Sequence |
>scFv anti-RAGE 10H6
DIQMTQSPSSLSASVGDGVTITCQASQDVGIYVNWFQQKPGKAPRRLIYRATNLADGVPS RFSGSRSGTDFTLTISSLQPEDFATYYCLEFDEHPLTFGGGTKVEIKNGGGSGGGGSGGG GSSEVQLVESGGGLVQPGGSLRLSCAASGFTFNNYWMTWVRQAPGKGLEWVASIDNSGDN TYYPDSVKDRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGDITTGLDYWGQGTLVTV SS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | scFv M4 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS057 | [1] | ||||
Scaffold Name | scFv | |||||
Scaffold Class | Antibody fragment | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Advanced glycosylation end product-specific receptor | Blocker | Research tool | N.A. | University College Dublin | [1] | |