General Information of Synthetic Binding Protein (SBP) (ID: SBP001822)
SBP Name
scFv anti-RAGE 3A6
Synonyms
scFv 3A6
Molecular Weight 25.8 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display and Ribosome display
Highest Status Research
Sequence Length 242
SBP Sequence
>scFv anti-RAGE 3A6
DIQMTQSPSSLSASVGDRVTITCRASQDVGIYVNWFQQKPGKAPRRLIYRATNLADGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCLEFDEHPLTFGGGTKVEIKDGGGSGGGGSGGG
GSSEVQLVESGGGLVQPGGSLRLSCAASGFTFNNYWMTWVRQAPGKGLEWVASIDNSGDN
TYYPDSVKDRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGGDILVSLDVWGQGTLVTV
SS
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name scFv M4
Protein Scaffold Information of This SBP
Scaffold ID PS057
Scaffold Info
[1]
Scaffold Name scFv
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Advanced glycosylation end product-specific receptor
BTS Info
Blocker Research tool N.A. University College Dublin [1]
References
1 Affinity maturation of a humanized rat antibody for anti-RAGE therapy: comprehensive mutagenesis reveals a high level of mutational plasticity both inside and outside the complementarity-determining regions. J Mol Biol. 2009 May 8;388(3):541-58.