Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00025) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Immunoglobulin G-binding protein A
|
|||||
Synonyms |
IgG-binding protein A; Staphylococcal protein A; SpA
|
|||||
BTS Type |
Protein
|
|||||
Family |
Immunoglobulin-binding protein SpA family
|
|||||
Gene Name |
spa
|
|||||
Organism |
Staphylococcus aureus (strain NCTC 8325 / PS 47)
|
|||||
Function |
Plays a role in the inhibition of the host innate and adaptive immune responses. Possesses five immunoglobulin-binding domains that capture both the fragment crystallizable region (Fc region) and the Fab region (part of Ig that identifies antigen) of immunoglobulins In turn, Staphylococcus aureus is protected from phagocytic killing via inhibition of Ig Fc region. In addition, the host elicited B-cell response is prevented due to a decrease of antibody-secreting cell proliferation that enter the bone marrow, thereby decreasing long-term antibody production. Inhibits osteogenesis by preventing osteoblast proliferation and expression of alkaline phosphatase, type I collagen, osteopontin and osteocalcin. Acts directly as a proinflammatory factor in the lung through its ability to bind and activate tumor necrosis factor alpha receptor 1/TNFRSF1A (By similarity).
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQ
RNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEA QRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQR NGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNG FIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFI QSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGK EDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGN GVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQ ALPETGEENPFIGTTVFGGLSLALGAALLAGRRREL |
|||||
Sequence Length |
516
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Affibody anti-SasA Z(SPA-1) | Research | Binder | Kd: 2000-6500 nM | Tools for expressing anti-idiotypic affibody pair | [1] | |
Affibody anti-SasA ZpA963 | Research | Binder | Kd: 20 nM | Research tool | [2] | |
Affitin anti-SasA C5 | Research | Binder | Kd: 108 nM | Staphylococcus aureus [ICD-11: XN6BM] | [3] | |
scFv anti-VEGF/SasA variants | Research | Binder | N.A. | Research tool | [4] | |
References |
---|