Details of the BTS | SYNBIP

General Information of Binding Target of SBP (BTS) (ID: ST00006)
BTS Name	Interleukin-23 subunit alpha
Synonyms	IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19
BTS Type	Protein
Family	IL-6 superfamily
Gene Name	IL23A
Organism	Homo sapiens (Human)
Function	Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
UniProt ID	Q9NPF7
UniProt Entry	IL23A_HUMAN
PFam	PF16649
Gene ID	51561
Sequence	MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF AHGAATLSP
Sequence Length	189

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
ABD-derived affinity protein anti-IL-23 clone ILP030	Research	Inhibitor	N.A.	Chronic autoimmune diseases [ICD-11: 4A4Z]	SBP Info	[1], [2]
ABD-derived affinity protein anti-IL-23 clone ILP317	Research	Inhibitor	N.A.	Chronic autoimmune diseases [ICD-11: 4A4Z]	SBP Info	[1], [2]
ABD-derived affinity protein anti-IL-23 clone ILP323	Research	Inhibitor	N.A.	Chronic autoimmune diseases [ICD-11: 4A4Z]	SBP Info	[1], [2]
Alphabody anti-IL-23 Cl59	Research	Antagonist	Kd: 3.8 nM	Psoriasis [ICD-11: EA90]; Multiple sclerosis [ICD-11: 8A40.Z]	SBP Info	[3]
Alphabody anti-IL-23 MA12	Research	Antagonist	Kd: 0.11? nM	Psoriasis [ICD-11: EA90]; Multiple sclerosis [ICD-11: 8A40.Z]	SBP Info	[3]
Alphabody anti-IL-23 MA5	Research	Antagonist	Kd: 0.1 nM	Psoriasis [ICD-11: EA90]; Multiple sclerosis [ICD-11: 8A40.Z]	SBP Info	[3]
Alphabody anti-TNF-alpha/IL-23 CMX-02	Research	Binder	N.A.	Psoriatic arthritis [ICD-11: FA21.Z]; Crohn disease [ICD-11: DD70.Z]	SBP Info	[4]
Monobody anti-IL-23 clone 2	Research	Antagonist	Kd: 2 nM	Tools as argeted biologics	SBP Info	[5], [6]

References

1	p19-targeted ABD-derived protein variants inhibit IL-23 binding and exert suppressive control over IL-23-stimulated expansion of primary human IL-17+ T-cells. Autoimmunity. 2017 Mar;50(2):102-113.
2	Novel high-affinity binders of human interferon gamma derived from albumin-binding domain of protein G. Proteins. 2012 Mar;80(3):774-89.
3	Structural basis of IL-23 antagonism by an Alphabody protein scaffold. Nat Commun. 2014 Oct 30;5:5237.
4	Complix. Product Development Pipeline. 2021.
5	Structures of adnectin/protein complexes reveal an expanded binding footprint. Structure. 2012 Feb 8;20(2):259-69.
6	Anti-tumor effect of CT-322 as an adnectin inhibitor of vascular endothelial growth factor receptor-2. MAbs. Mar-Apr 2010;2(2):199-208.