Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000592) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Alphabody anti-IL-23 Cl59
|
|||||
| Synonyms |
Alphabody Cl59
|
|||||
| Molecular Weight | 11.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 117 | |||||
| SBP Sequence |
>Alphabody anti-IL-23 Cl59
HMSIEEIQKQIASIQEVIAGIQKWIYMMTGGSGGSGGGGSGGSGGMSIEEIQKQIAAIQQ IAAIQKQIYAMTGSGGGGSGGSGGGGSGMSIEEIQKQITAIKEQIIAIYKQIMAMTP |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS008 | [1] | ||||
| Scaffold Name | Alphabody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Interleukin-23 subunit alpha | Antagonist | Psoriasis [ICD-11: EA90]; Multiple sclerosis [ICD-11: 8A40.Z] | Kd: 3.8 nM | Complix; Ghent University | [1] | |