Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000593) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Alphabody anti-IL-23 MA5
|
|||||
Synonyms |
Alphabody MA5
|
|||||
Molecular Weight | 11.5 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 110 | |||||
SBP Sequence |
>Alphabody anti-IL-23 MA5
HMSIKQIQKEIAQIQEVIAAIQKWIYRMTGGSGGSGGMSIEEIQKQIAAIQCQIAAIQKQ IYAMTGSGGGGSGGSGGGGSGMSIEEIQKQIAAIQDQIVAIYKQIMAMSS |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS008 | [1] | ||||
Scaffold Name | Alphabody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Interleukin-23 subunit alpha | Antagonist | Psoriasis [ICD-11: EA90]; Multiple sclerosis [ICD-11: 8A40.Z] | Kd: 0.1 nM | Complix; Ghent University | [1] | |