General Information of Synthetic Binding Protein (SBP) (ID: SBP000350)
SBP Name
ABD-derived affinity protein anti-IL-23 clone ILP030
Synonyms
ABD-derived affinity protein protein ILP030
Molecular Weight 5.2 kDa
Thermal Denaturation TEMP 52 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method Ribosome display
Highest Status Research
Sequence Length 46
SBP Sequence
>ABD-derived affinity protein anti-IL-23 clone ILP030
LAEAKVLANRELDKYGVSDVYKNTINPAAWVLAVKRMIDRILANLP
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Albumin-binding domain (ABD)
Protein Scaffold Information of This SBP
Scaffold ID PS001
Scaffold Info
[1] , [2]
Scaffold Name ABD-derived affinity protein
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Interleukin-23 subunit alpha
BTS Info
Inhibitor Chronic autoimmune diseases [ICD-11: 4A4Z] N.A. Czech Academy of Sciences [1] , [2]
References
1 p19-targeted ABD-derived protein variants inhibit IL-23 binding and exert suppressive control over IL-23-stimulated expansion of primary human IL-17+ T-cells. Autoimmunity. 2017 Mar;50(2):102-113.
2 Novel high-affinity binders of human interferon gamma derived from albumin-binding domain of protein G. Proteins. 2012 Mar;80(3):774-89.