Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003458) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Nanobody anti-Gs Nb35
|
|||||
| Synonyms |
Nanobody-35; Nanobody 35; Nb35
|
|||||
| Molecular Weight | 13.9 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli WK6 | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| PDB ID | 6NBF; 6NBH; 6NBI; 6PB0; 6PB1; 6VN7; 7CFM; 7CFN; 7CX2; 7CX3; 7CX4; 7CZ5; 7D68; 7DTY; 7DUQ; 7E14; 7EVM; 7JV5; 7JVP; 7JVQ; 7DUR | |||||
| Sequence Length | 128 | |||||
| SBP Sequence |
>Nanobody anti-Gs Nb35
QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISY TGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQ GTQVTVSS |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS048 | [1] , [2] | ||||
| Scaffold Name | Nanobody | |||||
| Scaffold Class | Antibody fragment | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 | Binder | Research tool | N.A. | Stanford University School of Medicine | [1] , [2] | |
| Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 | Binder | Research tool | N.A. | Stanford University School of Medicine | [1] , [2] | |
| Guanine nucleotide-binding protein G(s) subunit alpha isoforms short | Binder | Research tool | N.A. | Stanford University School of Medicine | [1] , [2] | |