Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001453)
SBP Name
DARPin anti-Cathepsin-B clone 8h6
Synonyms
DARPin 8h6
Molecular Weight 16.5 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli XL1-Blue
Selection Method Ribosome display
Highest Status Research
PDB ID 5MBM
Sequence Length 158
SBP Sequence
>DARPin anti-Cathepsin-B clone 8h6
GSDLGKKLLDAASAGQDDEVRILIANGADVNASDTYGRTPLHAAAWGHLEIVDVLLAYGA
DVNASDKWGYTPLHLAANEGHLEIVEVLLANGADVNASSQRGQTPLHVAATWGHLEIVDV
LLANGADVNANDRQGKTPFDLAIDNGNEDIAEVLQKAA
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Template Name AR module
Template Sequence Description X represents a randomized position to all amino acids except C and P; Z represents a randomized position to only N, H or Y.
Protein Scaffold Information of This SBP
Scaffold ID PS027
Scaffold Info
[1] , [2]
Scaffold Name DARPin
Scaffold Class Non-Antibody
Fold Type Alpha-Helices + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Cathepsin B
BTS Info
Inhibitor Non-invasive in vivo imaging of tumour-associated cathepsin B Kd: 0.031 nM Albert-Ludwigs-University Freiburg; Jozef Stefan Institut [1] , [2]
Cathepsin B
BTS Info
Inhibitor Non-invasive in vivo imaging of tumour-associated cathepsin B Kd: 0.2 nM Albert-Ludwigs-University Freiburg; Jozef Stefan Institut [1] , [2]
References
1 New Kid on the Block. Theranostics. 2017 Jul 30;7(11):2965-2967.
2 Non-invasive in vivo imaging of tumour-associated cathepsin B by a highly selective inhibitory DARPin. Theranostics. 2017 Jul 8;7(11):2806-2821.