Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000648) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affitin anti-DNA/HEWL mL3
|
|||||
| Synonyms |
Affitin mL3
|
|||||
| Molecular Weight | 8.8 kDa | |||||
| Thermal Denaturation TEMP | 60.9 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli DH5 (alpha) | |||||
| Highest Status | Research | |||||
| Sequence Length | 76 | |||||
| SBP Sequence |
>Affitin anti-DNA/HEWL mL3
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNSTIYASYYESGKTGRGAVSEKDA PKELLDMLARAEREKK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Sac7d | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS007 | [1] | ||||
| Scaffold Name | Affitin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | One Alpha-Helix + Beta-Sheets + Loops | |||||