Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00208) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Signal transducer and activator of transcription 3
|
|||||
| Synonyms |
Acute-phase response factor
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Transcription factor STAT family
|
|||||
| Gene Name |
STAT3
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4 Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes Activated by IL31 through IL31RA Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1 Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation (By similarity). May play an apoptotic role by transctivating BIRC5 expression under LEP activation Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion (By similarity).
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM |
|||||
| Sequence Length |
770
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Monobody anti-STAT3 MS3-1 | Research | Inhibitor | Kd: 127 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Monobody anti-STAT3 MS3-2 | Research | Inhibitor | Kd: 104 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Monobody anti-STAT3 MS3-4 | Research | Inhibitor | Kd: 18 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Monobody anti-STAT3 MS3-5 | Research | Inhibitor | Kd: 88 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Monobody anti-STAT3 MS3-N1 | Research | Inhibitor | Kd: 65 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Monobody anti-STAT3 MS3-N3 | Research | Inhibitor | Kd: 40 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Monobody anti-STAT3 MS3-N5 | Research | Inhibitor | Kd: 39 nM | Cancers [ICD-11: 2D4Z] | [1] | |
| Peptide aptamer anti-STAT3 rS3-PA | Research | Inhibitor | N.A. | Tumors [ICD-11: XH1N44] | [2] | |
| References |
|---|