Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001254)
SBP Name
Monobody anti-STAT3 MS3-N1
Synonyms
MS3-N1
Molecular Weight 10.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System A549 cells
Highest Status Research
Sequence Length 94
SBP Sequence
>Monobody anti-STAT3 MS3-N1
VSSVPTKLEVVAATPTSLLISWDAPAVTVDFYHITYGETGWYSGYQEFTVPGSKSTATIS
GLKPGVDYTITVYAAYMYYSQYEWSSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name 10th domain of fibronectin type III (10Fn3)
Template Sequence Description X denotes a mixture of 30% Tyr, 15% Ser, 10% Gly, 5% Phe, 5% Trp, and 2.5% each of all the other amino acids except for Cys; O denotes a mixture of Asn, Asp, His, Ile, Leu, Phe, Tyr, and Val; U denotes a mixture of His, Leu, Phe, and Tyr; Z denotes a mixture of Ala, Glu, Lys, and Thr.
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Signal transducer and activator of transcription 3
BTS Info
Inhibitor Cancers [ICD-11: 2D4Z] Kd: 65 nM Swiss Institute for Experimental Cancer Research (ISREC) [1]
References
1 Selective inhibition of STAT3 signaling using monobodies targeting the coiled-coil and N-terminal domains. Nat Commun. 2020 Aug 17;11(1):4115.