Details of the BTS
General Information of Binding Target of SBP (BTS) (ID: ST00195) | ||||||
---|---|---|---|---|---|---|
BTS Name |
Adhesion G-protein coupled receptor G1
|
|||||
Synonyms |
G-protein coupled receptor 56; Protein TM7XN1
|
|||||
BTS Type |
Protein
|
|||||
Family |
G-protein coupled receptor 2 family;
LN-TM7 subfamily |
|||||
Gene Name |
ADGRG1
|
|||||
Organism |
Homo sapiens (Human)
|
|||||
Function |
Receptor involved in cell adhesion and probably in cell-cell interactions. Mediates cell matrix adhesion in developing neurons and hematopoietic stem cells. Receptor for collagen III/COL3A1 in the developing brain and involved in regulation of cortical development, specifically in maintenance of the pial basement membrane integrity and in cortical lamination (By similarity). Binding to the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway by coupling to GNA13 and possibly GNA12 Plays a role in the maintenance of hematopoietic stem cells and/or leukemia stem cells in bone marrow niche (By similarity). Plays a critical role in cancer progression by inhibiting VEGFA production threreby inhibiting angiogenesis through a signaling pathway mediated by PRKCA Plays an essential role in testis development (By similarity).; [ADGRG1 N-terminal fragment]: Plays a critical role in cancer progression by activating VEGFA production and angiogenesis through a signaling pathway mediated by PRKCA
|
|||||
UniProt ID | ||||||
UniProt Entry | ||||||
PFam | ||||||
Gene ID | ||||||
Sequence |
MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIEN
SEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLL CFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELK RDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKL QPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQ DKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGH WSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAI FLHFSLLTCLSWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVD NYGPIILAVHRTPEGVIYPSMCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLR PHTQKWSHVLTLLGLSLVLGLPWALIFFSFASGTFQLVVLYLFSIITSFQGFLIFIWYWS MRLQARGGPSPLKSNSDSARLPISSGSTSSSRI |
|||||
Sequence Length |
693
|
|||||
Synthetic Binding Protein (SBP) Targeting This BTS |
---|
SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
---|---|---|---|---|---|---|
Monobody anti-GPR56 Alpha5 | Research | Agonist | Kd: 1.8 nM | Tools for oligodendrocyte development | [1] | |
Monobody anti-GPR56 clone beta1 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta14 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta16 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta18 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta19 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta2 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta3 | Research | Binder | Kd: 9.6 nM | aGPCR-targeted therapeutics | [3], [2] | |
Monobody anti-GPR56 clone beta4 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta5 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta6 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta7 | Research | Agonist | Kd: 66.7 nM | aGPCR-targeted therapeutics | [3], [2] | |
Monobody anti-GPR56 clone beta7 | Research | Agonist | Kd: 4 nM | aGPCR-targeted therapeutics | [3], [2] | |
Monobody anti-GPR56 clone beta8 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
Monobody anti-GPR56 clone beta9 | Research | Binder | N.A. | aGPCR-targeted therapeutics | [2] | |
References |
---|