General Information of Synthetic Binding Protein (SBP) (ID: SBP001300)
SBP Name
Monobody anti-GPR56 clone beta3
Synonyms
Monobody hGPR56_beta3
Molecular Weight 9.9 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (DE3)
Selection Method Phage display and yeast display
Highest Status Research
Sequence Length 93
SBP Sequence
>Monobody anti-GPR56 clone beta3
VSDVPRDLEVVAATPTSLLISWDAPAVTVDFYVITYGETGSGWFPGQTFEVPGSKSTATI
SGLKPGVDYTITVYTYGYSSLGPGSPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name 10th domain of fibronectin type III (10Fn3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Adhesion G-protein coupled receptor G1
BTS Info
Binder aGPCR-targeted therapeutics Kd: 9.6 nM University of Chicago [1] , [2]
Adhesion G-protein coupled receptor G1
BTS Info
Binder aGPCR-targeted therapeutics Kd: 130 nM University of Chicago [1] , [2]
References
1 Specific and direct modulation of the interaction between adhesion GPCR GPR56/ADGRG1 and tissue transglutaminase 2 using synthetic ligands. Sci Rep. 2020 Oct 9;10(1):16912.
2 Stachel-independent modulation of GPR56/ADGRG1 signaling by synthetic ligands directed to its extracellular region. Proc Natl Acad Sci U S A. 2017 Sep 19;114(38):10095-10100.