Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001208) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-GPR56 Alpha5
|
|||||
Synonyms |
Monobody Alpha5
|
|||||
Molecular Weight | 10.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Selection Method | Yeast display | |||||
Highest Status | Research | |||||
PDB ID | 5KVM | |||||
Sequence Length | 95 | |||||
SBP Sequence |
>Monobody anti-GPR56 Alpha5
SVPTKLEVVAATPTSLLISWDAPAVTVDHYVITYGETGGSPWSWQEFEVPGSKSTATISG LKPGVDYTITVYASSFDWTIFPNYYSSPISINYRT |
|||||
3D Structure | ||||||
Experimentally Validated Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Adhesion G-protein coupled receptor G1 | Agonist | Tools for oligodendrocyte development | Kd: 1.8 nM | University of Chicago | [1] | |