Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001313) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-GPR56 clone beta14
|
|||||
Synonyms |
Monobody hGPR56_beta14
|
|||||
Molecular Weight | 10.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (DE3) | |||||
Selection Method | Phage display and yeast display | |||||
Highest Status | Research | |||||
Sequence Length | 94 | |||||
SBP Sequence |
>Monobody anti-GPR56 clone beta14
VSDVPRDLEVVAATPTSLLISWDATGYYVRYYRITYGETGGNSPVQEFTVPGSSSTATIS GLKPGVDYTITVYAQSGPYYWYWGDSPISINYRT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | 10th domain of fibronectin type III (10Fn3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Adhesion G-protein coupled receptor G1 | Binder | aGPCR-targeted therapeutics | N.A. | University of Chicago | [1] | |