General Information of Binding Target of SBP (BTS) (ID: ST00193)
BTS Name
Estrogen receptor
Synonyms
ER; ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1
BTS Type
Protein
Family
Nuclear hormone receptor family;
NR3 subfamily
Gene Name
ESR1
Organism
Homo sapiens (Human)
Function
Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 ; [Isoform 3]: Involved in activation of NOS3 and endothelial nitric oxide production Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor Binds to ERE and inhibits isoform 1
UniProt ID
P03372
UniProt Entry
ESR1_HUMAN
PFam
PF12743 ; PF00104 ; PF02159 ; PF00105
Gene ID
2099
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Sequence Length
595
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Monobody anti-ER-alpha AB7-A1 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha AB7-B1 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#10 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#11 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#23 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[2], [1]
Monobody anti-ER-alpha E2#3 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#4 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#5 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#7 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#8 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E2#9 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E3#2 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha E3#6 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1], [3]
Monobody anti-ER-alpha OHT#31 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha OHT#32 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[1]
Monobody anti-ER-alpha OHT#33 Research Binder N.A. Tools for probing protein conformational changes
SBP Info
[2], [1], [4]
References
1 Probing protein conformational changes in living cells by using designer binding proteins: application to the estrogen receptor. Proc Natl Acad Sci U S A. 2002 Feb 5;99(3):1253-8.
2 Conformation-specific affinity purification of proteins using engineered binding proteins: application to the estrogen receptor. Protein Expr Purif. 2006 Jun;47(2):348-54.
3 Identification of regions within the F domain of the human estrogen receptor alpha that are important for modulating transactivation and protein-protein interactions. Mol Endocrinol. 2007 Apr;21(4):829-42.
4 The fibronectin type III domain as a scaffold for novel binding proteins. J Mol Biol. 1998 Dec 11;284(4):1141-51.