Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00193) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Estrogen receptor
|
|||||
| Synonyms |
ER; ER-alpha; Estradiol receptor; Nuclear receptor subfamily 3 group A member 1
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Nuclear hormone receptor family;
NR3 subfamily |
|||||
| Gene Name |
ESR1
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3 ; [Isoform 3]: Involved in activation of NOS3 and endothelial nitric oxide production Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor Binds to ERE and inhibits isoform 1
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV |
|||||
| Sequence Length |
595
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Monobody anti-ER-alpha AB7-A1 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha AB7-B1 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#10 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#11 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#23 | Research | Binder | N.A. | Tools for probing protein conformational changes | [2], [1] | |
| Monobody anti-ER-alpha E2#3 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#4 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#5 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#7 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#8 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E2#9 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E3#2 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha E3#6 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1], [3] | |
| Monobody anti-ER-alpha OHT#31 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha OHT#32 | Research | Binder | N.A. | Tools for probing protein conformational changes | [1] | |
| Monobody anti-ER-alpha OHT#33 | Research | Binder | N.A. | Tools for probing protein conformational changes | [2], [1], [4] | |
| References |
|---|