Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000033)
SBP Name
Monobody anti-ER-alpha E2#23
Synonyms
Monobody E2#23
Molecular Weight 12.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Yeast two-hybrid screen
Highest Status Research
PDB ID 2OCF
Sequence Length 113
SBP Sequence
>Monobody anti-ER-alpha E2#23
SSDYKDDDDKGENLYFQGSVSDVPTKLEVVAATPTSLLISWDAPAVTVRYYRITYGETGG
NSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGLRLMLAGSKPISINYRT
3D Structure
Experimentally Validated Structure
Click to Save PDB File
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Estrogen receptor
BTS Info
Binder Tools for probing protein conformational changes N.A. University of Chicago [1] , [2]
References
1 Conformation-specific affinity purification of proteins using engineered binding proteins: application to the estrogen receptor. Protein Expr Purif. 2006 Jun;47(2):348-54.
2 Probing protein conformational changes in living cells by using designer binding proteins: application to the estrogen receptor. Proc Natl Acad Sci U S A. 2002 Feb 5;99(3):1253-8.