Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP001342) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Monobody anti-ER-alpha E3#6
|
|||||
Synonyms |
Monobody E3#6
|
|||||
Molecular Weight | 10.2 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Yeast | |||||
Selection Method | Yeast two-hybrid screen | |||||
Highest Status | Research | |||||
Sequence Length | 95 | |||||
SBP Sequence |
>Monobody anti-ER-alpha E3#6
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVDYTITVYAVTGRILLNMLTSKPISINYRT |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Fibronectin type III domain (FN3) | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS047 | [1] , [2] | ||||
Scaffold Name | Monobody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Estrogen receptor | Binder | Tools for probing protein conformational changes | N.A. | University of Rochester School of Medicine and Dentistry; University of Chicago | [1] , [2] | |
References |
---|