Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP001342)
SBP Name
Monobody anti-ER-alpha E3#6
Synonyms
Monobody E3#6
Molecular Weight 10.2 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Yeast
Selection Method Yeast two-hybrid screen
Highest Status Research
Sequence Length 95
SBP Sequence
>Monobody anti-ER-alpha E3#6
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATIS
GLKPGVDYTITVYAVTGRILLNMLTSKPISINYRT
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Fibronectin type III domain (FN3)
Protein Scaffold Information of This SBP
Scaffold ID PS047
Scaffold Info
[1] , [2]
Scaffold Name Monobody
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Estrogen receptor
BTS Info
Binder Tools for probing protein conformational changes N.A. University of Rochester School of Medicine and Dentistry; University of Chicago [1] , [2]
References
1 Probing protein conformational changes in living cells by using designer binding proteins: application to the estrogen receptor. Proc Natl Acad Sci U S A. 2002 Feb 5;99(3):1253-8.
2 Identification of regions within the F domain of the human estrogen receptor alpha that are important for modulating transactivation and protein-protein interactions. Mol Endocrinol. 2007 Apr;21(4):829-42.