Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP001334) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Monobody anti-ER-alpha E2#4
|
|||||
| Synonyms |
Monobody E2#4
|
|||||
| Molecular Weight | 10.2 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Yeast | |||||
| Selection Method | Yeast two-hybrid screen | |||||
| Highest Status | Research | |||||
| Sequence Length | 94 | |||||
| SBP Sequence |
>Monobody anti-ER-alpha E2#4
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATIS GLKPGVDYTITVYAVTGRLLWNSLSKPISINYRT |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Fibronectin type III domain (FN3) | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS047 | [1] | ||||
| Scaffold Name | Monobody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Estrogen receptor | Binder | Tools for probing protein conformational changes | N.A. | University of Rochester School of Medicine and Dentistry | [1] | |