Details of the BTS | SYNBIP

General Information of Binding Target of SBP (BTS) (ID: ST00171)
BTS Name	Enterotoxin type B
Synonyms	SEB
BTS Type	Protein
Family	Staphylococcal/streptococcal toxin family
Gene Name	entB
Organism	Staphylococcus aureus
Function	Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of proinflammatory cytokines Causes also the intoxication staphylococcal food poisoning syndrome (By similarity).
UniProt ID	P01552
UniProt Entry	ETXB_STAAU
PFam	PF02876
Sequence	MYKRLFISHVILIFALILVISTPNVLAESQPDPKPDELHKSSKFTGLMENMKVLYDDNHV SAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQC YFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKK KVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKY LMMYNDNKMVDSKDVKIEVYLTTKKK
Sequence Length	266

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
Fab anti-SEB	Research	Binder	Kd: 4.1 nM	Research tool	SBP Info	[1]
Nanobody anti-SEB A3	Research	Binder	Kd: 0.14 nM	Research tool	SBP Info	[2]
Nanobody anti-SEB Aa	Research	Binder	Kd: 0.63 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB Ac	Research	Binder	Kd: 0.67 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB Ad	Research	Binder	Kd: 0.96 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB Ca	Research	Binder	Kd: 0.69 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB Cb	Research	Binder	Kd: 0.36 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB Cc	Research	Binder	Kd: 0.79 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB Cd	Research	Binder	Kd: 0.12 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB D9	Research	Binder	Kd: 0.11 nM	Research tool	SBP Info	[3]
Nanobody anti-SEB E2	Research	Binder	Kd: 0.27 nM	Research tool	SBP Info	[3]

References

1	Generation of Fab fragment-like molecular recognition proteins against staphylococcal enterotoxin B by phage display technology. Clin Vaccine Immunol. 2010 Nov;17(11):1708-17.
2	Contributions of the complementarity determining regions to the thermal stability of a single-domain antibody. PLoS One. 2013 Oct 15;8(10):e77678.
3	Next-Generation Sequencing of a Single Domain Antibody Repertoire Reveals Quality of Phage Display Selected Candidates. PLoS One. 2016 Feb 19;11(2):e0149393.