General Information of Synthetic Binding Protein (SBP) (ID: SBP003301)
SBP Name
Nanobody anti-SEB Ad
Synonyms
Nanobody Ad
Molecular Weight 16.0 kDa
Thermal Denaturation TEMP 60 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli Rosetta (DE3)
Selection Method Phage display
Highest Status Research
Sequence Length 152
SBP Sequence
>Nanobody anti-SEB Ad
LLLAAQPAMAEVQLQASGGGLVQPGGSLRLPCAASGLIFGSYAMGWFRQAPGKAREFVAA
ISWSGGDTYADSVKGRFTISRDNAKNTVYLQMNSLEPEDTAVYSCAAVGSKYYISKDAKD
YGYWGQGTQV TVSSEPKTPKPQPAASGAEFAA
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Consensus sequence
Protein Scaffold Information of This SBP
Scaffold ID PS048
Scaffold Info
[1]
Scaffold Name Nanobody
Scaffold Class Antibody fragment
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Enterotoxin type B
BTS Info
Binder Research tool Kd: 0.96 nM Postdoctoral Fellow at the US Naval Research Laboratory [1]
References
1 Next-Generation Sequencing of a Single Domain Antibody Repertoire Reveals Quality of Phage Display Selected Candidates. PLoS One. 2016 Feb 19;11(2):e0149393.