Details of the BTS

General Information of Binding Target of SBP (BTS) (ID: ST00022)
BTS Name
Protein E7
BTS Type
Protein
Family
Papillomaviridae E7 protein family
Gene Name
E7
Organism
Human papillomavirus type 16
Function
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
UniProt ID
P03129
UniProt Entry
VE7_HPV16
PFam
PF00527
Gene ID
1489079
Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK
CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Sequence Length
98
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Affibody anti-HPV16 Z(HPV16)127 Research Binder Kd: 48200 nM Imaging agent for patients with cervical cancer
SBP Info
 		[1]
Affibody anti-HPV16 Z(HPV16E7)301 Research Binder Kd: 2210 nM Imaging agent for patients with cervical cancer
SBP Info
 		[1]
Affibody anti-HPV16 Z(HPV16E7)384 Research Binder Kd: 2200 nM Imaging agent for patients with cervical cancer
SBP Info
 		[1]
Affibody anti-HPV16 Z(HPV16E7)745 Research Binder Kd: 1800 nM Imaging agent for patients with cervical cancer
SBP Info
 		[1]
Affilin anti-HPV16 D1C14 Research Binder Kd: 70 nM Cervical cancer [ICD-11: 2C77.Z]
SBP Info
 		[2]
Affilin anti-HPV16 D4C14 Research Binder Kd: 270 nM Cervical cancer [ICD-11: 2C77.Z]
SBP Info
 		[2]
Peptide aptamer anti-HPV16 16E730 Research Binder N.A. Research tool
SBP Info
 		[3]
References
1 Generation of affibody molecules specific for HPV16 E7 recognition. Oncotarget. 2016 Nov 8;7(45):73995-74005.
2 Affilin molecules selected against the human papillomavirus E7 protein inhibit the proliferation of target cells. J Mol Biol. 2009 Jul 24;390(4):710-21.
3 Peptide aptamer-mediated inhibition of target proteins by sequestration into aggresomes. J Biol Chem. 2006 Jul 28;281(30):21345-21352.