Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000248) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affilin anti-HPV16 D4C14
|
|||||
| Synonyms |
Affilin D4C14
|
|||||
| Molecular Weight | 21.0 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3); Escherichia coli NovaBlue (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 176 | |||||
| SBP Sequence |
>Affilin anti-HPV16 D4C14
GFIMFTEDRAFQGRRYDCGTDCPNLQPYFSRCNSIKVKSGCWMIYERPNYQGHQYFLRRG EYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCLSVQDRFHLTE IHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLYLE |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Gamma-B-crystallin | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS005 | [1] | ||||
| Scaffold Name | Affilin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Beta-Turns + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Protein E7 | Binder | Cervical cancer [ICD-11: 2C77.Z] | Kd: 270 nM | Martin Luther University Halle-Wittenberg | [1] | |