General Information of Synthetic Binding Protein (SBP) (ID: SBP000494)
SBP Name
Affibody anti-HPV16 Z(HPV16E7)745
Synonyms
Affibody Z(HPV16E7)745
Molecular Weight 6.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-HPV16 Z(HPV16E7)745
VDNKFNKEQVNAFAEIRHLPNLNPGQQNAFIQSLDDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Protein E7
BTS Info
Binder Imaging agent for patients with cervical cancer Kd: 1800 nM Wenzhou Medical University [1]
References
1 Generation of affibody molecules specific for HPV16 E7 recognition. Oncotarget. 2016 Nov 8;7(45):73995-74005.