Details of the BTS | SYNBIP

General Information of Binding Target of SBP (BTS) (ID: ST00013)
BTS Name	Beta-lactamase
Synonyms	EC 3.5.2.6
BTS Type	Protein
Family	Class-A beta-lactamase family
Gene Name	blaCTX-M-15
Organism	Klebsiella pneumoniae
UniProt ID	Q2PUH3
UniProt Entry	Q2PUH3_KLEPN
Sequence	MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGS GGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL
Sequence Length	291

Synthetic Binding Protein (SBP) Targeting This BTS

SBP Name	Highest Status	Mechanism	Affinity	Application	Details	Ref
Affibody anti-CTX-M-15 A50	Research	Binder	Kd: 420 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A51	Research	Binder	Kd: 330 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A511	Research	Binder	Kd: 1600 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A52	Research	Binder	Kd: 600 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A529	Research	Binder	Kd: 1100 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A545	Research	Binder	Kd: 80 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A546	Research	Binder	Kd: 40 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A5888	Research	Binder	Kd: 2100 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]
Affibody anti-CTX-M-15 A59947	Research	Binder	Kd: 470 nM	Tools for versatile retargeting of SH3 domain binding	SBP Info	[1]

References

1

Combination of ribosome display and next generation sequencing as a powerful method for identification of affibody binders against -lactamase CTX-M15. N Biotechnol. 2019 May 25;50:60-69.