Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000482) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Affibody anti-CTX-M-15 A59947
|
|||||
| Synonyms |
Affibody A59947
|
|||||
| Molecular Weight | 6.6 kDa | |||||
| Thermal Denaturation TEMP | 38.8 ℃ | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (gammaDE3) | |||||
| Selection Method | Ribosome display and Next generation sequencing | |||||
| Highest Status | Research | |||||
| Sequence Length | 58 | |||||
| SBP Sequence |
>Affibody anti-CTX-M-15 A59947
VDNKFNKEQRPAVYEIWQLPNLNEVQYSAFIFSLMDDPSQSANLLAEAKKLNDAQAPK |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Z domain of staphylococcal protein A | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS004 | [1] | ||||
| Scaffold Name | Affibody | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Three Alpha-Helices | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Beta-lactamase | Binder | Tools for versatile retargeting of SH3 domain binding | Kd: 470 nM | BIOASTER | [1] | |