Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000480)
SBP Name
Affibody anti-CTX-M-15 A50
Synonyms
Affibody A50
Molecular Weight 6.6 kDa
Thermal Denaturation TEMP 43.9 ℃
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli BL21 (gammaDE3)
Selection Method Ribosome display and Next generation sequencing
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-CTX-M-15 A50
VDNKFNKEQRPAIYEIRWLPNLNELQDQAFIGSLQDDPSQSANLLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Z domain of staphylococcal protein A
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Beta-lactamase
BTS Info
Binder Tools for versatile retargeting of SH3 domain binding Kd: 420 nM BIOASTER [1]
References
1 Combination of ribosome display and next generation sequencing as a powerful method for identification of affibody binders against -lactamase CTX-M15. N Biotechnol. 2019 May 25;50:60-69.