Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000479) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Affibody anti-CTX-M-15 A51
|
|||||
Synonyms |
Affibody A51
|
|||||
Molecular Weight | 6.6 kDa | |||||
Thermal Denaturation TEMP | 42.3 ℃ | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli BL21 (gammaDE3) | |||||
Selection Method | Ribosome display and Next generation sequencing | |||||
Highest Status | Research | |||||
Sequence Length | 58 | |||||
SBP Sequence |
>Affibody anti-CTX-M-15 A51
VDNKFNKEQRPAVYEIWQLPNLNEEQWTAFIVSLVDDPSQSANLLAEAKKLNDAQAPK |
|||||
3D Structure |
|
|||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Z domain of staphylococcal protein A | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS004 | [1] | ||||
Scaffold Name | Affibody | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Three Alpha-Helices | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Beta-lactamase | Binder | Tools for versatile retargeting of SH3 domain binding | Kd: 330 nM | BIOASTER | [1] | |