Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00012) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
T-cell surface glycoprotein CD3 epsilon chain
|
|||||
| Synonyms |
T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e
|
|||||
| BTS Type |
Protein
|
|||||
| Gene Name |
CD3E
|
|||||
| Organism |
Homo sapiens (Human)
|
|||||
| Function |
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Gene ID | ||||||
| Sequence |
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP PPVPNPDYEPIRKGQRDLYSGLNQRRI |
|||||
| Sequence Length |
207
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Abl/Hck SH3 domain anti-CD3E Epsilon1 | Research | Binder | N.A. | Tools for versatile retargeting of SH3 domain binding | [1] | |
| Abl/Hck SH3 domain anti-CD3E Epsilon2 | Research | Binder | N.A. | Tools for versatile retargeting of SH3 domain binding | [1] | |
| Abl/Hck SH3 domain anti-CD3E Epsilon3 | Research | Binder | N.A. | Tools for versatile retargeting of SH3 domain binding | [1] | |
| Affimer anti-CD3/CD3E AVA-002 | Research | Binder | N.A. | Cancers [ICD-11: 2D4Z] | [2] | |
| BiTE anti-CD38/CD3E | Research | Activator | N.A. | Multiple myeloma [ICD-11: 2A83.Y] | [3] | |
| scFv Emerfetamab | Phase I | Binder | N.A. | Acute myeloid leukaemia [ICD-11: XH8AA5] | [4] | |
| VNAR anti-EpCAM/CD3E B1 | Research | Binder | Kd: 422 nM | Research tool | [5] | |
| References |
|---|