Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP000820) | ||||||
---|---|---|---|---|---|---|
SBP Name |
Abl/Hck SH3 domain anti-CD3E Epsilon1
|
|||||
Synonyms |
Abl/Hck SH3 domain-based binder Epsilon1
|
|||||
Molecular Weight | 6.4 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | Escherichia coli | |||||
Selection Method | Phage display | |||||
Highest Status | Research | |||||
Sequence Length | 57 | |||||
SBP Sequence |
>Abl/Hck SH3 domain anti-CD3E Epsilon1
GPNSHNSNTPGIREAGSEDIIVVALYDYWGRNAMDLSFQKGDQMVVLEESGEWWKAR |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Template Name | Hck-SH3 | |||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS003 | [1] | ||||
Scaffold Name | Abl/Hck SH3 domain | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Beta-Sheets + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
T-cell surface glycoprotein CD3 epsilon chain | Binder | Tools for versatile retargeting of SH3 domain binding | N.A. | University of Tampere; Tampere University Hospital | [1] | |