General Information of Synthetic Binding Protein (SBP) (ID: SBP000820)
SBP Name
Abl/Hck SH3 domain anti-CD3E Epsilon1
Synonyms
Abl/Hck SH3 domain-based binder Epsilon1
Molecular Weight 6.4 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 57
SBP Sequence
>Abl/Hck SH3 domain anti-CD3E Epsilon1
GPNSHNSNTPGIREAGSEDIIVVALYDYWGRNAMDLSFQKGDQMVVLEESGEWWKAR
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Hck-SH3
Protein Scaffold Information of This SBP
Scaffold ID PS003
Scaffold Info
[1]
Scaffold Name Abl/Hck SH3 domain
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
T-cell surface glycoprotein CD3 epsilon chain
BTS Info
Binder Tools for versatile retargeting of SH3 domain binding N.A. University of Tampere; Tampere University Hospital [1]
References
1 Versatile retargeting of SH3 domain binding by modification of non-conserved loop residues. FEBS Lett. 2007 May 1;581(9):1735-41.