Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000821) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Abl/Hck SH3 domain anti-CD3E Epsilon2
|
|||||
| Synonyms |
Abl/Hck SH3 domain-based binder Epsilon2
|
|||||
| Molecular Weight | 6.4 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 57 | |||||
| SBP Sequence |
>Abl/Hck SH3 domain anti-CD3E Epsilon2
GPNSHNSNTPGIREAGSEDIIVVALYDYLATNRYDLSFQKGDQMVVLEESGEWWKAR |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Hck-SH3 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS003 | [1] | ||||
| Scaffold Name | Abl/Hck SH3 domain | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| T-cell surface glycoprotein CD3 epsilon chain | Binder | Tools for versatile retargeting of SH3 domain binding | N.A. | University of Tampere; Tampere University Hospital | [1] | |