Details of the BTS
| General Information of Binding Target of SBP (BTS) (ID: ST00009) | ||||||
|---|---|---|---|---|---|---|
| BTS Name |
Protein Nef
|
|||||
| Synonyms |
3'ORF; Negative factor; F-protein
|
|||||
| BTS Type |
Protein
|
|||||
| Family |
Lentivirus primate group Nef protein family
|
|||||
| Gene Name |
nef
|
|||||
| Organism |
Human immunodeficiency virus 1
|
|||||
| Function |
Bypasses host T-cell signaling by inducing a transcriptional program nearly identical to that of anti-CD3 cell activation. Interaction with TCR-zeta chain up-regulates the Fas ligand (FasL). Increasing surface FasL molecules and decreasing surface MHC-I molecules on infected CD4(+) cells send attacking cytotoxic CD8+ T-lymphocytes into apoptosis.; Extracellular Nef protein targets CD4(+) T-lymphocytes for apoptosis by interacting with CXCR4 surface receptors.; Factor of infectivity and pathogenicity, required for optimal virus replication. Alters numerous pathways of T-lymphocytes function and down-regulates immunity surface molecules in order to evade host defense and increase viral infectivity. Alters the functionality of other immunity cells, like dendritic cells, monocytes/macrophages and NK cells.; In infected CD4(+) T-lymphocytes, down-regulates the surface MHC-I, mature MHC-II, CD4, CD28, CCR5 and CXCR4 molecules. Mediates internalization and degradation of host CD4 through the interaction of with the cytoplasmic tail of CD4, the recruitment of AP-2 (clathrin adapter protein complex 2), internalization through clathrin coated pits, and subsequent transport to endosomes and lysosomes for degradation. Diverts host MHC-I molecules to the trans-Golgi network-associated endosomal compartments by an endocytic pathway to finally target them for degradation. MHC-I down-regulation may involve AP-1 (clathrin adapter protein complex 1) or possibly Src family kinase-ZAP70/Syk-PI3K cascade recruited by PACS2. In consequence infected cells are masked for immune recognition by cytotoxic T-lymphocytes. Decreasing the number of immune receptors also prevents reinfection by more HIV particles (superinfection). Down-regulates host SERINC3 and SERINC5 thereby excluding these proteins from the viral particles. Virion infectivity is drastically higher when SERINC3 or SERINC5 are excluded from the viral envelope, because these host antiviral proteins impare the membrane fusion event necessary for subsequent virion penetration.; Plays a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Protects the infected cells from apoptosis in order to keep them alive until the next virus generation is ready to strike. Inhibits the Fas and TNFR-mediated death signals by blocking MAP3K5/ASK1. Decreases the half-life of TP53, protecting the infected cell against p53-mediated apoptosis. Inhibits the apoptotic signals regulated by the Bcl-2 family proteins through the formation of a Nef/PI3-kinase/PAK2 complex that leads to activation of PAK2 and induces phosphorylation of host BAD.
|
|||||
| UniProt ID | ||||||
| UniProt Entry | ||||||
| PFam | ||||||
| Sequence |
MGGKWSKSKTAGWPEVRERIRNAPSAAAPGVGAVSQDLAKHGAITSSNANHPSCVWLEAQ
EDEEVGFPVRPQVPLRPMTYKGALDLSHFLKEKGGLEGLIYSRRRQEILDLWVYHTQGYF PDWQNYTPGPGIRYPLTFGWCFKLVPVEPEEVEKATEGENNSLLHPICQHGMDDEEGEVL KWQFDPRLALKHRAQELHPEFYKDC |
|||||
| Sequence Length |
205
|
|||||
| Synthetic Binding Protein (SBP) Targeting This BTS |
|---|
| SBP Name | Highest Status | Mechanism | Affinity | Application | Details | Ref |
|---|---|---|---|---|---|---|
| Abl/Hck SH3 domain anti-ADAM15/HIV-1 clone 15.2 | Research | Binder | N.A. | Tools for versatile retargeting of SH3 domain binding | [1] | |
| Abl/Hck SH3 domain anti-ADAM15/HIV-1 clone 15.3 | Research | Binder | N.A. | Tools for versatile retargeting of SH3 domain binding | [1] | |
| Abl/Hck SH3 domain anti-HIV-1 Nef A1 | Research | Inhibitor | Kd: 7 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [2] | |
| Abl/Hck SH3 domain anti-HIV-1 Nef B4 | Research | Inhibitor | N.A. | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [2] | |
| Abl/Hck SH3 domain anti-HIV-1 Nef B6 | Research | Inhibitor | Kd: 7 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [2] | |
| Abl/Hck SH3 domain anti-HIV-1 Nef C1 | Research | Inhibitor | Kd: 7 nM | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | [2] | |
| Abl/Hck SH3 domain anti-PAK-1/HIV-1 P3 | Research | Binder | N.A. | Tools for versatile retargeting of SH3 domain binding | [1] | |