General Information of Binding Target of SBP (BTS) (ID: ST00009)
BTS Name
Protein Nef
Synonyms
3'ORF; Negative factor; F-protein
BTS Type
Protein
Family
Lentivirus primate group Nef protein family
Gene Name
nef
Organism
Human immunodeficiency virus 1
Function
Bypasses host T-cell signaling by inducing a transcriptional program nearly identical to that of anti-CD3 cell activation. Interaction with TCR-zeta chain up-regulates the Fas ligand (FasL). Increasing surface FasL molecules and decreasing surface MHC-I molecules on infected CD4(+) cells send attacking cytotoxic CD8+ T-lymphocytes into apoptosis.; Extracellular Nef protein targets CD4(+) T-lymphocytes for apoptosis by interacting with CXCR4 surface receptors.; Factor of infectivity and pathogenicity, required for optimal virus replication. Alters numerous pathways of T-lymphocytes function and down-regulates immunity surface molecules in order to evade host defense and increase viral infectivity. Alters the functionality of other immunity cells, like dendritic cells, monocytes/macrophages and NK cells.; In infected CD4(+) T-lymphocytes, down-regulates the surface MHC-I, mature MHC-II, CD4, CD28, CCR5 and CXCR4 molecules. Mediates internalization and degradation of host CD4 through the interaction of with the cytoplasmic tail of CD4, the recruitment of AP-2 (clathrin adapter protein complex 2), internalization through clathrin coated pits, and subsequent transport to endosomes and lysosomes for degradation. Diverts host MHC-I molecules to the trans-Golgi network-associated endosomal compartments by an endocytic pathway to finally target them for degradation. MHC-I down-regulation may involve AP-1 (clathrin adapter protein complex 1) or possibly Src family kinase-ZAP70/Syk-PI3K cascade recruited by PACS2. In consequence infected cells are masked for immune recognition by cytotoxic T-lymphocytes. Decreasing the number of immune receptors also prevents reinfection by more HIV particles (superinfection). Down-regulates host SERINC3 and SERINC5 thereby excluding these proteins from the viral particles. Virion infectivity is drastically higher when SERINC3 or SERINC5 are excluded from the viral envelope, because these host antiviral proteins impare the membrane fusion event necessary for subsequent virion penetration.; Plays a role in optimizing the host cell environment for viral replication without causing cell death by apoptosis. Protects the infected cells from apoptosis in order to keep them alive until the next virus generation is ready to strike. Inhibits the Fas and TNFR-mediated death signals by blocking MAP3K5/ASK1. Decreases the half-life of TP53, protecting the infected cell against p53-mediated apoptosis. Inhibits the apoptotic signals regulated by the Bcl-2 family proteins through the formation of a Nef/PI3-kinase/PAK2 complex that leads to activation of PAK2 and induces phosphorylation of host BAD.
UniProt ID
A0A1B3YVD5
UniProt Entry
A0A1B3YVD5_9HIV1
PFam
PF00469
Sequence
MGGKWSKSKTAGWPEVRERIRNAPSAAAPGVGAVSQDLAKHGAITSSNANHPSCVWLEAQ
EDEEVGFPVRPQVPLRPMTYKGALDLSHFLKEKGGLEGLIYSRRRQEILDLWVYHTQGYF
PDWQNYTPGPGIRYPLTFGWCFKLVPVEPEEVEKATEGENNSLLHPICQHGMDDEEGEVL
KWQFDPRLALKHRAQELHPEFYKDC
Sequence Length
205
Synthetic Binding Protein (SBP) Targeting This BTS
SBP Name Highest Status Mechanism Affinity Application Details Ref
Abl/Hck SH3 domain anti-ADAM15/HIV-1 clone 15.2 Research Binder N.A. Tools for versatile retargeting of SH3 domain binding
SBP Info
[1]
Abl/Hck SH3 domain anti-ADAM15/HIV-1 clone 15.3 Research Binder N.A. Tools for versatile retargeting of SH3 domain binding
SBP Info
[1]
Abl/Hck SH3 domain anti-HIV-1 Nef A1 Research Inhibitor Kd: 7 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[2]
Abl/Hck SH3 domain anti-HIV-1 Nef B4 Research Inhibitor N.A. Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[2]
Abl/Hck SH3 domain anti-HIV-1 Nef B6 Research Inhibitor Kd: 7 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[2]
Abl/Hck SH3 domain anti-HIV-1 Nef C1 Research Inhibitor Kd: 7 nM Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z]
SBP Info
[2]
Abl/Hck SH3 domain anti-PAK-1/HIV-1 P3 Research Binder N.A. Tools for versatile retargeting of SH3 domain binding
SBP Info
[1]
References
1 Versatile retargeting of SH3 domain binding by modification of non-conserved loop residues. FEBS Lett. 2007 May 1;581(9):1735-41.
2 SH3 domains with high affinity and engineered ligand specificities targeted to HIV-1 Nef. J Mol Biol. 1999 Nov 12;293(5):1097-106.