Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP000811) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
Abl/Hck SH3 domain anti-HIV-1 Nef B6
|
|||||
| Synonyms |
Abl/Hck SH3 domain-based binder B6
|
|||||
| Molecular Weight | 6.5 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Expression System | Escherichia coli BL21 (DE3) | |||||
| Selection Method | Phage display | |||||
| Highest Status | Research | |||||
| Sequence Length | 57 | |||||
| SBP Sequence |
>Abl/Hck SH3 domain anti-HIV-1 Nef B6
GPNSHNSNTPGIREAGSEDIIVVALYDYYSPFSWDLSFQKGDQMVVLEESGEWWKAR |
|||||
| 3D Structure | ||||||
| Computationally Modelled Structure | ||||||
| Click to Save PDB File | ||||||
| Template Name | Hck-SH3 | |||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS003 | [1] | ||||
| Scaffold Name | Abl/Hck SH3 domain | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Beta-Sheets + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Protein Nef | Inhibitor | Human immunodeficiency virus infection (HIV infection) [ICD-11: 1C62.Z] | Kd: 7 nM | University of Tampere | [1] | |