Details of the SBP

General Information of Synthetic Binding Protein (SBP) (ID: SBP000819)
SBP Name
Abl/Hck SH3 domain anti-ADAM15/HIV-1 clone 15.3
Synonyms
Abl/Hck SH3 domain-based binder 15.3
Molecular Weight 6.3 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Expression System Escherichia coli
Selection Method Phage display
Highest Status Research
Sequence Length 57
SBP Sequence
>Abl/Hck SH3 domain anti-ADAM15/HIV-1 clone 15.3
GPNSHNSNTPGIREAGSEDIIVVALYDYMAQCIGDLSFQKGDQMVVLEESGEWWKAR
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Hck-SH3
Protein Scaffold Information of This SBP
Scaffold ID PS003
Scaffold Info
[1]
Scaffold Name Abl/Hck SH3 domain
Scaffold Class Non-Antibody
Fold Type Beta-Sheets + Loops
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Protein Nef
BTS Info
Binder Tools for versatile retargeting of SH3 domain binding N.A. University of Tampere; Tampere University Hospital [1]
Disintegrin and metalloproteinase domain-containing protein 15
BTS Info
Binder Tools for versatile retargeting of SH3 domain binding N.A. University of Tampere; Tampere University Hospital [1]
References
1 Versatile retargeting of SH3 domain binding by modification of non-conserved loop residues. FEBS Lett. 2007 May 1;581(9):1735-41.