Details of the SBP
| General Information of Synthetic Binding Protein (SBP) (ID: SBP003619) | ||||||
|---|---|---|---|---|---|---|
| SBP Name |
DARPin anti-IgE E3_53
|
|||||
| Synonyms |
DARPin E3_53
|
|||||
| Molecular Weight | 18.8 kDa | |||||
| Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
| Selection Method | yeast display | |||||
| Highest Status | Research | |||||
| PDB ID | 7MXI | |||||
| Sequence Length | 173 | |||||
| SBP Sequence |
>DARPin anti-IgE E3_53
MRGSHHHHHHGSDDDDKSSDLGKKLLEAARAGQDDEVRILMANGADVNAIDHNGTTPLHL AAYAGHLEIVEVLLKHGADVNARDLRGFTPLHLAAIDGHLEIVEVLLKYGADVNADDDYG TTPLHLAAQYGHMEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQ |
|||||
| 3D Structure | ||||||
| Experimentally Validated Structure | ||||||
| Click to Save PDB File | ||||||
| Protein Scaffold Information of This SBP | ||||||
|---|---|---|---|---|---|---|
| Scaffold ID | PS027 | [1] | ||||
| Scaffold Name | DARPin | |||||
| Scaffold Class | Non-Antibody | |||||
| Fold Type | Alpha-Helices + Loops | |||||
| Binding Target(s) of This SBP (BTS) |
|---|
| BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
|---|---|---|---|---|---|---|
| Immunoglobulin E | Inhibitor | Allergies [ICD-11: 4A84.Z] | Kd: 21.48 nM | Stanford University | [1] | |