Details of the SBP
General Information of Synthetic Binding Protein (SBP) (ID: SBP003612) | ||||||
---|---|---|---|---|---|---|
SBP Name |
DARPin anti-Stx2a 10B
|
|||||
Synonyms |
DARPin 10B
|
|||||
Molecular Weight | 16.1 kDa | |||||
Design Method | Traditional methods (Site-directed mutagenesis and/or Directed evolution) | |||||
Expression System | E. coli BL21(DE3) | |||||
Selection Method | phage display | |||||
Highest Status | Research | |||||
Sequence Length | 163 | |||||
SBP Sequence |
>DARPin anti-Stx2a 10B
GKKLLEAARAGQDDEVRILMANGADVNAGDPFGFTPLHLAAMFGHLEIVEVLLKNGADVN AHDEYGFTPLHLAAVVGHLEIVEVLLKNGADVNACDNQGGTPLHLAAVDGHLEIVEVLLK HGADVNAQDKFGKTAFDISIDNGNEDLAEILQ |
|||||
3D Structure | ||||||
Computationally Modelled Structure | ||||||
Click to Save PDB File | ||||||
Protein Scaffold Information of This SBP | ||||||
---|---|---|---|---|---|---|
Scaffold ID | PS027 | [1] | ||||
Scaffold Name | DARPin | |||||
Scaffold Class | Non-Antibody | |||||
Fold Type | Alpha-Helices + Loops | |||||
Binding Target(s) of This SBP (BTS) |
---|
BTS Name | Details | Mechanism | Application | Affinity | Research Organization | Ref |
---|---|---|---|---|---|---|
Shiga-like toxin 2 subunit A | Inhibitor | Shiga toxin-producing E. coli infection (STEC infection) [ICD-11: XN108] | Kd: 3450 nM | Texas A&M University | [1] | |