General Information of Synthetic Binding Protein (SBP) (ID: SBP003564)
SBP Name
Affibody anti-SARS-CoV-2 Z327
Synonyms
Affibody Z327
Molecular Weight 6.1 kDa
Design Method Traditional methods (Site-directed mutagenesis and/or Directed evolution)
Selection Method phage display
Highest Status Research
Sequence Length 58
SBP Sequence
>Affibody anti-SARS-CoV-2 Z327
VDNKFNKEQLTAPAEISILPNLNGAQGGAFIGSLEDDPSQSAELLAEAKKLNDAQAPK
3D Structure
Computationally Modelled Structure
Click to Save PDB File
Template Name Zwt
Protein Scaffold Information of This SBP
Scaffold ID PS004
Scaffold Info
[1]
Scaffold Name Affibody
Scaffold Class Non-Antibody
Fold Type Three Alpha-Helices
Binding Target(s) of This SBP (BTS)
BTS Name Details Mechanism Application Affinity Research Organization Ref
Spike glycoprotein
BTS Info
Neutralizer COVID-19 [ICD-11: RA01.3] Kd: 661 nM Wenzhou Medical University [1]
References
1 Novel Affibody Molecules Specifically Bind to SARS-CoV-2 Spike Protein and Efficiently Neutralize Delta and Omicron Variants. Microbiol Spectr. 2023 Feb 14;11(1):e0356222.